Request QuoteCatalog Number: xP309118BRJSize: 0.2-1mg

Request Quote

Recombinant Uncharacterized protein ydcF (ydcF)

Recombinant Uncharacterized protein ydcF (ydcF) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP309118BRJYeast1mgQuote
EP309118BRJE. coli1mgQuote
BP309118BRJBaculovirus200ugQuote
MP309118BRJMammalian Cell200ugQuote

Protein Information

SpeciesBacillus subtilis (strain 168)
UniProt IDP96623
Gene NameydcF; Locus:BSU04750
Protein NameUncharacterized protein ydcF
Region Expressed1-97
Expression Tag6xHis
Purity>90%
AA SequenceMERKEHCFCKEKQFSYGLSMWRNIGRFLSWSTCPHSNVIMEFFHVLQKQKEDLCITYGIV LEGAEAKKWGEIIGTELSKDMPTAVSRLVHLYGGVIK
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review