Request QuoteCatalog Number: xP515293SXVSize: 0.2-1mg

Request Quote

Recombinant Uncharacterized protein P23A10.17 (SPBP23A10.17)

Recombinant Uncharacterized protein P23A10.17 (SPBP23A10.17) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP515293SXVYeast1mgQuote
EP515293SXVE. coli1mgQuote
BP515293SXVBaculovirus200ugQuote
MP515293SXVMammalian Cell200ugQuote

Protein Information

SpeciesSchizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
UniProt IDG2TRQ4
Gene NameORFs:SPBP23A10.17
Protein NameUncharacterized protein P23A10.17
Region Expressed23-118
Expression Tag6xHis
Purity>90%
AA SequenceAGVQALISTSKQNKDELLTATEALETDKQLYKKIEKKIEELESSCVKKSSWEIQESEWKA MFQTMRVEYLELLEKQKTLGEVLNKLVEDRQTKFQF
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review