Request QuoteCatalog Number: xP518816SXVSize: 0.2-1mg

Request Quote

Recombinant Uncharacterized protein C4H3.16 (SPAC4H3.16)

Recombinant Uncharacterized protein C4H3.16 (SPAC4H3.16) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP518816SXVYeast1mgQuote
EP518816SXVE. coli1mgQuote
BP518816SXVBaculovirus200ugQuote
MP518816SXVMammalian Cell200ugQuote

Protein Information

SpeciesSchizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
UniProt IDG2TRN0
Gene NameORFs:SPAC4H3.16
Protein NameUncharacterized protein C4H3.16
Region Expressed1-107
Expression Tag6xHis
Purity>90%
AA SequenceMKRCRSEHVPSRLPRKKCKNHLDMRSFLSLFASKKSNAHDASSIVLNEKVNFVTDNDHLP SSTGVCEFCDNVLYLSTCDRCQRNICRNCSTLMYFKENTVARCLDCL
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review