Request QuoteCatalog Number: xP522297SXVSize: 0.2-1mg

Request Quote

Recombinant Uncharacterized protein C8E11.12 (SPAC8E11.12)

Recombinant Uncharacterized protein C8E11.12 (SPAC8E11.12) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP522297SXVYeast1mgQuote
EP522297SXVE. coli1mgQuote
BP522297SXVBaculovirus200ugQuote
MP522297SXVMammalian Cell200ugQuote

Protein Information

SpeciesSchizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
UniProt IDG2TRM4
Gene NameORFs:SPAC8E11.12
Protein NameUncharacterized protein C8E11.12
Region Expressed1-102
Expression Tag6xHis
Purity>90%
AA SequenceMISLLSIKMQAIKELDSEEEPKVGEFYKGNTISFCKNSLENDTQLPQILFCINPKSIRNF LFPPIAISDPKEAQNHCSSYYYIKYRYYIVQSRCGMMGRMSF
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review