Request QuoteCatalog Number: xP520736SXVSize: 0.2-1mg

Request Quote

Recombinant Uncharacterized protein C1399.06 (SPAC1399.06)

Recombinant Uncharacterized protein C1399.06 (SPAC1399.06) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP520736SXVYeast1mgQuote
EP520736SXVE. coli1mgQuote
BP520736SXVBaculovirus200ugQuote
MP520736SXVMammalian Cell200ugQuote

Protein Information

SpeciesSchizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
UniProt IDG2TRK4
Gene NameORFs:SPAC1399.06
Protein NameUncharacterized protein C1399.06
Region Expressed22-124
Expression Tag6xHis
Purity>90%
AA SequenceHTHSSSLPPYRLHCTALSYRDLLTKKSANFRSPIYRSHVNEKGTLTHSFRPTKDMQSGNC WFTILRKARNLLNHGILLSSNNRSFCFIIQISKINPFERFLEM
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review