Request QuoteCatalog Number: xP520550SXVSize: 0.2-1mg

Request Quote

Recombinant Uncharacterized protein tam1 (tam1)

Recombinant Uncharacterized protein tam1 (tam1) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP520550SXVYeast1mgQuote
EP520550SXVE. coli1mgQuote
BP520550SXVBaculovirus200ugQuote
MP520550SXVMammalian Cell200ugQuote

Protein Information

SpeciesSchizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
UniProt IDG2TRJ4
Gene Nametam1; ORFs:SPAC222.19
Protein NameUncharacterized protein tam1
Region Expressed1-117
Expression Tag6xHis
Purity>90%
AA SequenceMSVSQQLSELASKEKTVLYVADQNLEEVLCFPESTDRTTLVQLTDACLHANELAKHLEFG KPLSITNQYSRGSCVLQIAKEKKDGSGMVVSTTIAAHNALRGALKCSNALDQVISQL
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review