Request QuoteCatalog Number: xP520671HUSize: 0.2-1mg

Request Quote

Recombinant Uncharacterized protein C8orf87 (C8orf87)

Recombinant Uncharacterized protein C8orf87 (C8orf87) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP520671HUYeast1mgQuote
EP520671HUE. coli1mgQuote
BP520671HUBaculovirus200ugQuote
MP520671HUMammalian Cell200ugQuote

Protein Information

SpeciesHomo sapiens (Human)
UniProt IDE5RJ46
Gene NameC8orf87
Protein NameUncharacterized protein C8orf87
Region Expressed1-101
Expression Tag6xHis
Purity>90%
AA SequenceMRTPKRTRSPKTKVSLRGETLTLQLTTVSLDTRHMVKRCDERHGRPLPHSQESQHGSATS KKAVRGTADTAPLERISAARGWALPMEATVSVFRAHQWQWN
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review