Request QuoteCatalog Number: xP539115MOSize: 0.2-1mg

Request Quote

Recombinant Uncharacterized protein C1orf122 homolog

Recombinant Uncharacterized protein C1orf122 homolog can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP539115MOYeast1mgQuote
EP539115MOE. coli1mgQuote
BP539115MOBaculovirus200ugQuote
MP539115MOMammalian Cell200ugQuote

Protein Information

SpeciesMus musculus (Mouse)
UniProt IDB1ARW8
Gene Name
Protein NameUncharacterized protein C1orf122 homolog
Region Expressed1-110
Expression Tag6xHis
Purity>90%
AA SequenceMEWGPGAGWSRGEAAGVDRGKAGLGLGGRPPPQPPRDERAQQLLDAVEQRQRQLLDTIAA CEEMLRQLGRRRPEPAGGGNGSAKSGAPPQPSVSARGGLPKDAGDGASES
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review