Request QuoteCatalog Number: xP002409NHESize: 0.2-1mg

Request Quote

Recombinant V-type proton ATPase subunit G 2 (VATG2)

Recombinant V-type proton ATPase subunit G 2 (VATG2) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP002409NHEYeast1mgQuote
EP002409NHEE. coli1mgQuote
BP002409NHEBaculovirus200ugQuote
MP002409NHEMammalian Cell200ugQuote

Protein Information

SpeciesNicotiana tabacum (Common tobacco)
UniProt IDO82703
Gene NameVATG2; aka: VAG2
Protein NameV-type proton ATPase subunit G 2
Region Expressed1-111
Expression Tag6xHis
Purity>90%
AA SequenceMESNRGSQNGIQLLLGAEQEAQHIVNAARTGKQARMKQAKEEAEKEIAEFRAYMEAEFQR NVEQTSGDSGANVKRLEQETFAKIQHLKTEAESISHDVVQMLLRQVTTVKN
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review