Request QuoteCatalog Number: xP002409HUSize: 0.2-1mg

Request Quote

Recombinant V-type proton ATPase subunit G 2 (ATP6V1G2)

Recombinant V-type proton ATPase subunit G 2 (ATP6V1G2) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP002409HUYeast1mgQuote
EP002409HUE. coli1mgQuote
BP002409HUBaculovirus200ugQuote
MP002409HUMammalian Cell200ugQuote

Protein Information

SpeciesHomo sapiens (Human)
UniProt IDO95670
Gene NameATP6V1G2; aka: ATP6G, ATP6G2, NG38
Protein NameV-type proton ATPase subunit G 2
Region Expressed1-118
Expression Tag6xHis
Purity>90%
AA SequenceMASQSQGIQQLLQAEKRAAEKVADARKRKARRLKQAKEEAQMEVEQYRREREHEFQSKQQ AAMGSQGNLSAEVEQATRRQVQGMQSSQQRNRERVLAQLLGMVCDVRPQVHPNYRISA
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review