Request QuoteCatalog Number: xP517951MSRSize: 0.2-1mg

Request Quote

Recombinant V-type ATP synthase subunit F (atpF)

Recombinant V-type ATP synthase subunit F (atpF) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP517951MSRYeast1mgQuote
EP517951MSRE. coli1mgQuote
BP517951MSRBaculovirus200ugQuote
MP517951MSRMammalian Cell200ugQuote

Protein Information

SpeciesMethanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) (Methanobacterium thermoautotrophicum)
UniProt IDO27037
Gene NameatpF; Locus:MTH_956
Protein NameV-type ATP synthase subunit F
Region Expressed1-106
Expression Tag6xHis
Purity>90%
AA SequenceMSSNIAVVGDRDTVTGFRLGGVREGYVVETPDEAEETIRNLIRDGFSIIIVTEKIGDELR EFIEETTSSSALPMIIEIPDKTGPSERETDPLRDLIKRVIGVEMVK
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review