Request QuoteCatalog Number: xP511571TMPSize: 0.2-1mg

Request Quote

Recombinant V-type ATP synthase subunit F (atpF)

Recombinant V-type ATP synthase subunit F (atpF) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP511571TMPYeast1mgQuote
EP511571TMPE. coli1mgQuote
BP511571TMPBaculovirus200ugQuote
MP511571TMPMammalian Cell200ugQuote

Protein Information

SpeciesThermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3)
UniProt IDC5A335
Gene NameatpF; Locus:TGAM_0145
Protein NameV-type ATP synthase subunit F
Region Expressed1-102
Expression Tag6xHis
Purity>90%
AA SequenceMKIAVMGDPDTALGFKLAGAHEVYSFGSSPLEIERANNKLKELVERDDIGIILITETLAQ RVEVPEVEFPIILQIPDKSGSRFGEAQLREIVRRAIGVELKR
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review