Request QuoteCatalog Number: xP368275BOSize: 0.2-1mg

Request Quote

Recombinant Transmembrane protein C7orf23 homolog

Recombinant Transmembrane protein C7orf23 homolog can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP368275BOYeast1mgQuote
EP368275BOE. coli1mgQuote
BP368275BOBaculovirus200ugQuote
MP368275BOMammalian Cell200ugQuote

Protein Information

SpeciesBos taurus (Bovine)
UniProt IDA0JNK6
Gene Name
Protein NameTransmembrane protein C7orf23 homolog
Region Expressed1-118
Expression Tag6xHis
Purity>90%
AA SequenceMEDFSTRTYGTSGLDNRPLFGETSAKDRIINLVVGSLTSLLILVTLISAFVFPQLPPKPL NIFFAVCISLSSITACILIYWYRQGDLEPKFRNLIYYILFSIIMLCICANLYFHDVGK
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review