Request QuoteCatalog Number: xP514243MOSize: 0.2-1mg

Request Quote

Recombinant Transmembrane protein 233 (Tmem233)

Recombinant Transmembrane protein 233 (Tmem233) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP514243MOYeast1mgQuote
EP514243MOE. coli1mgQuote
BP514243MOBaculovirus200ugQuote
MP514243MOMammalian Cell200ugQuote

Protein Information

SpeciesMus musculus (Mouse)
UniProt IDD3Z1U7
Gene NameTmem233
Protein NameTransmembrane protein 233
Region Expressed1-110
Expression Tag6xHis
Purity>90%
AA SequenceMSQYASRSDSKGALDSSSPEAYTEDDKTEEDIPAPSNYLWLTIISCFCPAYPVNIVALVF SIMSLNSYNDGDYEGARRLGRNAKWVAIASIIIGLVIIGVSCAVHFSRNP
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review