Request QuoteCatalog Number: xP518959SVQSize: 0.2-1mg

Request Quote

Recombinant Topoisomerase I damage affected protein 2 (TDA2)

Recombinant Topoisomerase I damage affected protein 2 (TDA2) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP518959SVQYeast1mgQuote
EP518959SVQE. coli1mgQuote
BP518959SVQBaculovirus200ugQuote
MP518959SVQMammalian Cell200ugQuote

Protein Information

SpeciesSaccharomyces cerevisiae (strain VIN 13) (Baker's yeast)
UniProt IDE7LTG2
Gene NameTDA2; ORFs:VIN13_1342
Protein NameTopoisomerase I damage affected protein 2
Region Expressed1-104
Expression Tag6xHis
Purity>90%
AA SequenceMQIEIKDGRSDNSPLPERKLVTLIQESYDSLKDDNEINLSTESTSNLLIKLVLEKLEKHS SLYKYIASVTTLNIEGLNEENANFSLKNDIGASWESKKRWYIQL
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review