Request QuoteCatalog Number: xP509687ESQSize: 0.2-1mg

Request Quote

Recombinant Thiosulfate sulfurtransferase glpE (glpE)

Recombinant Thiosulfate sulfurtransferase glpE (glpE) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP509687ESQYeast1mgQuote
EP509687ESQE. coli1mgQuote
BP509687ESQBaculovirus200ugQuote
MP509687ESQMammalian Cell200ugQuote

Protein Information

SpeciesPectobacterium carotovorum subsp. carotovorum (strain PC1)
UniProt IDC6DH73
Gene NameglpE; Locus:PC1_3931
Protein NameThiosulfate sulfurtransferase glpE
Region Expressed1-107
Expression Tag6xHis
Purity>90%
AA SequenceMEQFEAISIEQAHSRWQEGGVVVDIRDPQSFAAAHVPGATHLTNETLSDFVRGADFEAPV MVICYHGISSRNAAQYLISLGFDSVYSIDGGFEAWQNRYPQDTQAQA
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review