$90.00Catalog Number: PYT586-5ugSize: 5ug

TFF1 Human

Trefoil Factor-1 Human Recombinant

TFF-1 Human Recombinant produced in E.Coli is a homodimer, non-glycosylated, polypeptide chain containing 2 x 60 amino acids which includes a 40 amino acid trefoil motif containing 3 conserved interamolecular disulfide bonds and having a total molecular mass of 13.2 kDa.
TFF-1 Human Recombinant is purified by proprietary chromatographic techniques.

Accession

P04155

Amino acid sequence

EAQTETCTVAPRERQNCGFPGVTPSQCANKGCCFDDTVRGVPWCFY
PNTIDVPPEEECEF.

Biological Activity

Determined by its ability to activate ERK1/2 (a MAPkinase signaling molecule) using a concentration 1,000-2,000ng/ml corresponding to a specific activity of 500-1,000IU/mg.

Formulation

The protein was lyophilized after dialysis against 1xPBS pH-7.4.

Physical Appearance

Sterile Filtered White lyophilized (freeze-dried) powder.

Purity

Greater than 97.0% as determined by:
(a) Analysis by RP-HPLC.
(b) Analysis by SDS-PAGE.

Solubility

It is recommended to reconstitute the lyophilized TFF1 in sterile 18MΩ-cm H2O not less than 100ug/ml, which can then be further diluted to other aqueous solutions.

Source

Escherichia Coli.

Stability

Lyophilized TFF1 although stable at room temperature for 3 weeks, should be stored desiccated below -18oC. Upon reconstitution TFF1 should be stored at 4oC between 2-7 days and for future use below
-18oC.
For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Please prevent freeze-thaw cycles.

Synonyms

TFF-1, TFF1, pS2, BCEI, HPS, HP1.A, pNR-2, D21S21, pS2 protein, Trefoil factor 1, Breast cancer estrogen-inducible protein.

Quantity

$90.00

ReviewsWrite Review