Request QuoteCatalog Number: xP534622RASize: 0.2-1mg

Request Quote

Recombinant Succinate dehydrogenase assembly factor 1, mitochondrial (Sdhaf1)

Recombinant Succinate dehydrogenase assembly factor 1, mitochondrial (Sdhaf1) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP534622RAYeast1mgQuote
EP534622RAE. coli1mgQuote
BP534622RABaculovirus200ugQuote
MP534622RAMammalian Cell200ugQuote

Protein Information

SpeciesRattus norvegicus (Rat)
UniProt IDB0K036
Gene NameSdhaf1
Protein NameSuccinate dehydrogenase assembly factor 1, mitochondrial
Region Expressed1-118
Expression Tag6xHis
Purity>90%
AA SequenceMSRLSRLQRQVLSLYRELLRAGRGKPGAEARVRAEFRQHASLPRSDVLRIEYLYRRGRRQ LQLLRSGHATAMGTFVRPRGPTEEPVDATAPGNRLDDSDALKNPCEGTGARETRSDGR
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review