Request QuoteCatalog Number: xP511373SVNSize: 0.2-1mg

Request Quote

Recombinant Stationary phase protein 4 (SPG4)

Recombinant Stationary phase protein 4 (SPG4) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP511373SVNYeast1mgQuote
EP511373SVNE. coli1mgQuote
BP511373SVNBaculovirus200ugQuote
MP511373SVNMammalian Cell200ugQuote

Protein Information

SpeciesSaccharomyces cerevisiae (strain Lalvin EC1118 / Prise de mousse) (Baker's yeast)
UniProt IDC8ZEW0
Gene NameSPG4; ORFs:EC1118_1M3_2795g
Protein NameStationary phase protein 4
Region Expressed1-115
Expression Tag6xHis
Purity>90%
AA SequenceMGSFWDAFAVYDKKKHADPSVYGGNHNNTGDSKTQVMFSKEYRQPRTHQQENLQSMRRSS IGSQDSSDVEDVKEGRLPAEVEIPKNVDISNMSQGEFLRLYESLRRGEPDNKVNR
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review