Request QuoteCatalog Number: xP528551SHSize: 0.2-1mg

Request Quote

Recombinant Spermatid nuclear transition protein 3

Recombinant Spermatid nuclear transition protein 3 can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP528551SHYeast1mgQuote
EP528551SHE. coli1mgQuote
BP528551SHBaculovirus200ugQuote
MP528551SHMammalian Cell200ugQuote

Protein Information

SpeciesOvis aries (Sheep)
UniProt IDO97965
Gene Name
Protein NameSpermatid nuclear transition protein 3
Region Expressed2-110
Expression Tag6xHis
Purity>90%
AA SequenceAKGTRKPRQPRRVAVRFASRMKGRKKTLWQRRYRGSVKAPNMTMRVRRPLKGTLRKKIRS YATPSKKVKNTREPNCFLRSCAREKLNQSRKRYQNMRQSQRRGQNQKRR
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review