Request QuoteCatalog Number: xP526667MOSize: 0.2-1mg

Request Quote

Recombinant Small proline-rich protein 2H (Sprr2h)

Recombinant Small proline-rich protein 2H (Sprr2h) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP526667MOYeast1mgQuote
EP526667MOE. coli1mgQuote
BP526667MOBaculovirus200ugQuote
MP526667MOMammalian Cell200ugQuote

Protein Information

SpeciesMus musculus (Mouse)
UniProt IDO70559
Gene NameSprr2h
Protein NameSmall proline-rich protein 2H
Region Expressed1-108
Expression Tag6xHis
Purity>90%
AA SequenceMSYQQQQCKQPCQPPPVCPPPQCPEPCPPPKCPEPCPPPKCTEPCPPPKCPEPCPPPKCP EPCPPPKCPEPCPPPKCTEPCPPPSYQQKCPSVQPSPPCQQKCPPKNK
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review