Request QuoteCatalog Number: xP518935FHSSize: 0.2-1mg

Request Quote

Recombinant Signal peptidase complex catalytic subunit sec11 (sec11)

Recombinant Signal peptidase complex catalytic subunit sec11 (sec11) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP518935FHSYeast1mgQuote
EP518935FHSE. coli1mgQuote
BP518935FHSBaculovirus200ugQuote
MP518935FHSMammalian Cell200ugQuote

Protein Information

SpeciesPyrenophora teres f. teres (strain 0-1) (Barley net blotch fungus) (Drechslera teres f. teres)
UniProt IDE3RR70
Gene Namesec11; ORFs:PTT_11281
Protein NameSignal peptidase complex catalytic subunit sec11
Region Expressed1-173
Expression Tag6xHis
Purity>90%
AA SequenceMLGIADMQPRQLAAQVLNFALVLSTAFMMWKGLSAASDSPSPIVVVLSGSMEPAFQRGDL LFLWNRGADTQVGEIVVYNVKGKDIPIVHRVVRRYGGGKTPLRLLTKGDNNLADDTELYA AGQSFLNRQEDVIGSVVGFIPFVGYVTILLSEHPWLKQVMLGMMGVMVVLQRE
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review