Request QuoteCatalog Number: xP003050HUSize: 0.2-1mg

Request Quote

Recombinant V-set and transmembrane domain-containing protein 5 (VSTM5)

Recombinant V-set and transmembrane domain-containing protein 5 (VSTM5) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP003050HUYeast1mgQuote
EP003050HUE. coli1mgQuote
BP003050HUBaculovirus200ugQuote
MP003050HUMammalian Cell200ugQuote

Protein Information

SpeciesHomo sapiens (Human)
UniProt IDA8MXK1
Gene NameVSTM5; aka: C11orf90
Protein NameV-set and transmembrane domain-containing protein 5
Region Expressed29-147
Expression Tag6xHis
Purity>90%
AA SequenceLQSQGVSLYIPQATINATVKEDILLSVEYSCHGVPTIEWTYSSNWGTQKIVEWKPGTQAN ISQSHKDRVCTFDNGSIQLFSVGVRDSGYYVITVTERLGSSQFGTIVLHVSEILYEDLH
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review