P31431

MASIRETEVIDPQDLLEGRYFSGALPDDEDVVGPGQESDDFELSGSGD
LDDLEDSMIGPEVVHPLVPLDNHIPERAGSGSQVPTEPKKLEENEVIPK
RISPVEESEDVSNKVSMSSTVQGSNIFERTEVLALEHHHHHH.

The SDC4 (1 mg/ml) was lyophilized after extensive dialyses against 20mM PBS pH-7.4.

Sterile Filtered White lyophilized (freeze-dried) powder.

Greater than 95.0% as determined by:
(a) Analysis by RP-HPLC.
(b) Analysis by SDS-PAGE.

It is recommended to reconstitute the lyophilized SDC4 in sterile 18MΩ-cm H₂O not less than 100 ug/ml, which can then be further diluted to other aqueous solutions.

Escherichia Coli.

Lyophilized SDC4 although stable at room temperature for 3 weeks, should be stored desiccated below -18^oC. Upon reconstitution SDC4 should be stored at 4^oC between 2-7 days and for future use below -18^oC. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles.

SDC4, SYND4, SYND-4, Amphiglycan, Ryudocan core protein, Syndecan-4.