Ribose 1,5-bisphosph-->

Request QuoteCatalog Number: xP510608ESSSize: 0.2-1mg

Recombinant Ribose 1,5-bisphosphate phosphokinase PhnN (phnN)

Recombinant Ribose 1,5-bisphosphate phosphokinase PhnN (phnN) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog Number	Expression Host	Amount	In Stock
YP510608ESS	Yeast	1mg	Quote
EP510608ESS	E. coli	1mg	Quote
BP510608ESS	Baculovirus	200ug	Quote
MP510608ESS	Mammalian Cell	200ug	Quote

Protein Information

Species	Pectobacterium wasabiae (strain WPP163)
UniProt ID	D0KG93
Gene Name	phnN; Locus:Pecwa_0582
Protein Name	Ribose 1,5-bisphosphate phosphokinase PhnN
Region Expressed	1-188
Expression Tag	6xHis
Purity	>90%
AA Sequence	MTKLIYLIGPSGAGKDSLLRAIRQLSLPHLLVAHRYITRPAEIQGENHIALTPEEFAIRQ QLGIFALNWQAHQCHYGIGIEIDYWLQRGSDVIVNGSRAYLTQARERYGNTLFPICLTVS ESALRQRLRARGRESEQQIAMRLQRAEEEQNRLQSDCVLLNNDGDLQHTLSTFQSLLPLD RACTAHRE
Storage Buffer	PBS pH 7.4, 50% glycerol
Storage	Store working aliquots at 4^oC for upto a week. Freeze at -20 to -80^oC for long term storage. Avoid repeated freeze/thaw.

Request Quote

ReviewsWrite Review

Products