Ribose 1,5-bisphosph-->

Request QuoteCatalog Number: xP518924EKTSize: 0.2-1mg

Recombinant Ribose 1,5-bisphosphate phosphokinase PhnN (phnN)

Recombinant Ribose 1,5-bisphosphate phosphokinase PhnN (phnN) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog Number	Expression Host	Amount	In Stock
YP518924EKT	Yeast	1mg	Quote
EP518924EKT	E. coli	1mg	Quote
BP518924EKT	Baculovirus	200ug	Quote
MP518924EKT	Mammalian Cell	200ug	Quote

Protein Information

Species	Enterobacter cloacae (strain SCF1)
UniProt ID	E3G1M3
Gene Name	phnN; Locus:Entcl_4075
Protein Name	Ribose 1,5-bisphosphate phosphokinase PhnN
Region Expressed	1-189
Expression Tag	6xHis
Purity	>90%
AA Sequence	MTGKLIWLVGPSGSGKDSLLEALRKQEHPQMLVAHRYITRPAGAGCENHVALSEHEFFTR AAQHLFALSWHANNLYYGVGMEIDLWLHAGLDVVVNGSRAHLPQAKARYGESLLPVCLQV SPDILRQRLEQRGRENALEIAQRLERAARYTPQQCVMLNNDGSLLQSVEMFLHLIRTHGN HKESQHACL
Storage Buffer	PBS pH 7.4, 50% glycerol
Storage	Store working aliquots at 4^oC for upto a week. Freeze at -20 to -80^oC for long term storage. Avoid repeated freeze/thaw.

Request Quote

ReviewsWrite Review

Products