Request QuoteCatalog Number: xP008434Size: 0.2-1mg

Request Quote

Recombinant (Rhesus macaque) Tumor necrosis factor ligand superfamily member 6 (FASLG)

Recombinant (Rhesus macaque) Tumor necrosis factor ligand superfamily member 6 (FASLG) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP008434Yeast1mgQuote
EP008434E. coli1mgRPA031Si01
BP008434Baculovirus200ugQuote
MP008434Mammalian Cell200ugQuote

Protein Information

SpeciesMacaca mulatta (Rhesus macaque)
UniProt IDP63307
Gene NameFASLG; aka: CD95L, FASL, TNFSF6
Protein NameTumor necrosis factor ligand superfamily member 6
Region Expressed102-280
Expression Tag6xHis
Purity>90%
AA SequenceQLFHLQKELAELRESTSQKHTASSLEKQIGHPSPPPEKKEQRKVAHLTGKPNSRSMPLEW EDTYGIVLLSGVKYKKGGLVINETGLYFVYSKVYFRGQSCTNLPLSHKVYMRNSKYPQDL VMMEGKMMSYCTTGQMWAHSSYLGAVFNLTSADHLYVNVSELSLVNFEESQTFFGLYKL
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review