Request QuoteCatalog Number: xP021034Size: 0.2-1mg

Request Quote

Recombinant (Rhesus macaque) Selenoprotein W (SEPW1)

Recombinant (Rhesus macaque) Selenoprotein W (SEPW1) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP021034Yeast1mgQuote
EP021034E. coli1mgQuote
BP021034Baculovirus200ugQuote
MP021034Mammalian Cell200ugQuote

Protein Information

SpeciesMacaca mulatta (Rhesus macaque)
UniProt IDP63303
Gene NameSEPW1; aka: SELW
Protein NameSelenoprotein W
Region Expressed2-87
Expression Tag6xHis
Purity>90%
AA SequenceALAVRVVYCGAUGYKSKYLQLKKKLEDEFPGRLDICGEGTPQATGFFEVMVAGKLIHSKK KGDGYVDTESKFLKLVAAIKAALAQG
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review