Request QuoteCatalog Number: xP020623Size: 0.2-1mg

Request Quote

Recombinant (Rhesus macaque) Protein S100-A10 (S100A10)

Recombinant (Rhesus macaque) Protein S100-A10 (S100A10) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP020623Yeast1mgQuote
EP020623E. coli1mgQuote
BP020623Baculovirus200ugQuote
MP020623Mammalian Cell200ugQuote

Protein Information

SpeciesMacaca mulatta (Rhesus macaque)
UniProt IDP62504
Gene NameS100A10; aka: CAL1L
Protein NameProtein S100-A10
Region Expressed2-97
Expression Tag6xHis
Purity>90%
AA SequencePSQMEHAMETMMFTFHKFAGDKGYLTKEDLRVLMEKEFPGFLENQKDPLAVDKIMKDLDQ CRDGKVGFQSFFSLIAGLTIACNDYFVVHMKQKGKK
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review