Request QuoteCatalog Number: xP015057Size: 0.2-1mg

Request Quote

Recombinant (Rhesus macaque) Growth/differentiation factor 8 (MSTN)

Recombinant (Rhesus macaque) Growth/differentiation factor 8 (MSTN) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP015057Yeast1mgQuote
EP015057E. coli1mgQuote
BP015057Baculovirus200ugQuote
MP015057Mammalian Cell200ugQuote

Protein Information

SpeciesMacaca mulatta (Rhesus macaque)
UniProt IDA1C2U6
Gene NameMSTN; aka: GDF8
Protein NameGrowth/differentiation factor 8
Region Expressed267-375
Expression Tag6xHis
Purity>90%
AA SequenceDFGLDCDEHSTESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGECEFVFLQKYPHTHL VHQANPRGSAGPCCTPTKMSPINMLYFNGKEQIIYGKIPAMVVDRCGCS
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review