Request QuoteCatalog Number: xP005293Size: 0.2-1mg

Request Quote

Recombinant (Rhesus macaque) Glycoprotein hormones alpha chain (CGA)

Recombinant (Rhesus macaque) Glycoprotein hormones alpha chain (CGA) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP005293Yeast1mgQuote
EP005293E. coli1mgQuote
BP005293Baculovirus200ugQuote
MP005293Mammalian Cell200ugQuote

Protein Information

SpeciesMacaca mulatta (Rhesus macaque)
UniProt IDP22762
Gene NameCGA
Protein NameGlycoprotein hormones alpha chain
Region Expressed25-120
Expression Tag6xHis
Purity>90%
AA SequenceFPDGEFTMQDCPECKPRENKFFSKPGAPIYQCMGCCFSRAYPTPVRSKKTMLVQKNVTSE STCCVAKSLTRVMVMGSVRVENHTECHCSTCYYHKF
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review