Request QuoteCatalog Number: xP002212Size: 0.2-1mg

Request Quote

Recombinant (Rhesus macaque) Agouti-signaling protein (ASIP)

Recombinant (Rhesus macaque) Agouti-signaling protein (ASIP) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP002212Yeast1mgQuote
EP002212E. coli1mgQuote
BP002212Baculovirus200ugQuote
MP002212Mammalian Cell200ugQuote

Protein Information

SpeciesMacaca mulatta (Rhesus macaque)
UniProt IDA1YL67
Gene NameASIP
Protein NameAgouti-signaling protein
Region Expressed23-132
Expression Tag6xHis
Purity>90%
AA SequenceHLPPEEKLRDDRSLRSNSSVNLLDFPSVSIMALNKNSKEISRKEAEKKRSSKKEASMKKV ARPRTPLSAPCVATRDSCKPPAPACCDPCASCQCRFFRSACSCRVLSLNC
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review