Request QuoteCatalog Number: xP519019SXVSize: 0.2-1mg

Request Quote

Recombinant Putative uncharacterized protein P35G2.17 (SPBP35G2.17)

Recombinant Putative uncharacterized protein P35G2.17 (SPBP35G2.17) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP519019SXVYeast1mgQuote
EP519019SXVE. coli1mgQuote
BP519019SXVBaculovirus200ugQuote
MP519019SXVMammalian Cell200ugQuote

Protein Information

SpeciesSchizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
UniProt IDG2TRS6
Gene NameORFs:SPBP35G2.17
Protein NamePutative uncharacterized protein P35G2.17
Region Expressed1-106
Expression Tag6xHis
Purity>90%
AA SequenceMVREFYVTGRGRKLLPTVFRIKSFHGIVRQCVKQQRDFTSFLASSPAMGVAQGQQVKLIL MLLIETWETKHQSCHSHFILLEFTHLFVRKFSQIFFEFRLFAHLLS
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review