Request QuoteCatalog Number: xP517267SXVSize: 0.2-1mg

Request Quote

Recombinant Putative uncharacterized protein C1071.13 (SPAC1071.13)

Recombinant Putative uncharacterized protein C1071.13 (SPAC1071.13) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP517267SXVYeast1mgQuote
EP517267SXVE. coli1mgQuote
BP517267SXVBaculovirus200ugQuote
MP517267SXVMammalian Cell200ugQuote

Protein Information

SpeciesSchizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
UniProt IDG2TRN1
Gene NameORFs:SPAC1071.13
Protein NamePutative uncharacterized protein C1071.13
Region Expressed1-105
Expression Tag6xHis
Purity>90%
AA SequenceMGRSNHLFIFIHWKSRSIFSGNNKVYRFSNLYVRTNSWQKVRHLESLHTNAYIVPLEMRL IIMKTRQTFKVHGMRKRKYYWKNDYMRGKNRNGNLPTKKHQSKKM
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review