Request QuoteCatalog Number: xP428074HUSize: 0.2-1mg

Request Quote

Recombinant Putative uncharacterized protein ENSP00000381830

Recombinant Putative uncharacterized protein ENSP00000381830 can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP428074HUYeast1mgQuote
EP428074HUE. coli1mgQuote
BP428074HUBaculovirus200ugQuote
MP428074HUMammalian Cell200ugQuote

Protein Information

SpeciesHomo sapiens (Human)
UniProt IDA8MUN3
Gene Name
Protein NamePutative uncharacterized protein ENSP00000381830
Region Expressed36-132
Expression Tag6xHis
Purity>90%
AA SequenceAEHLPHRPAVEKDVPGAGEVLFMCSWRIFPVASASPSSSISGLAGHSVFLVPGLAAHPGS HSDQPPGVPSRRKSRLERWSPSVSRSTSPPTEAPFCL
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review