Request QuoteCatalog Number: xP494594HUSize: 0.2-1mg

Request Quote

Recombinant Putative protein shisa-8 (SHISA8)

Recombinant Putative protein shisa-8 (SHISA8) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP494594HUYeast1mgQuote
EP494594HUE. coli1mgQuote
BP494594HUBaculovirus200ugQuote
MP494594HUMammalian Cell200ugQuote

Protein Information

SpeciesHomo sapiens (Human)
UniProt IDB8ZZ34
Gene NameSHISA8; aka: C22orf17
Protein NamePutative protein shisa-8
Region Expressed39-138
Expression Tag6xHis
Purity>90%
AA SequenceGAPEAQGPAAPGTTAPEGGDRCRGYYDVMGQWDPPFNCSSGAYSFCCGTCGYRFCCHDGP RRLDQSRCSNYDTPAWVQTGRPPARARDTAAPRDPGRERS
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review