Request QuoteCatalog Number: xP536576HUSize: 0.2-1mg

Request Quote

Recombinant Putative peripheral benzodiazepine receptor-related protein (TSPO)

Recombinant Putative peripheral benzodiazepine receptor-related protein (TSPO) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP536576HUYeast1mgQuote
EP536576HUE. coli1mgQuote
BP536576HUBaculovirus200ugQuote
MP536576HUMammalian Cell200ugQuote

Protein Information

SpeciesHomo sapiens (Human)
UniProt IDB1AH88
Gene NameTSPO; aka: PBRS
Protein NamePutative peripheral benzodiazepine receptor-related protein
Region Expressed1-102
Expression Tag6xHis
Purity>90%
AA SequenceMAPHLLWCPTNGLGLGGSPAGQWGGGSHYRGLVPGEPAGRPPALPLPGLAGLHDHTQLLR MAGQPWLAWGTAAARVSARPTRDCSCTSRCHHACDVVAVTLS
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review