Request QuoteCatalog Number: xP428070HUSize: 0.2-1mg

Request Quote

Recombinant Putative golgin subfamily A member 2-like protein 5

Recombinant Putative golgin subfamily A member 2-like protein 5 can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP428070HUYeast1mgQuote
EP428070HUE. coli1mgQuote
BP428070HUBaculovirus200ugQuote
MP428070HUMammalian Cell200ugQuote

Protein Information

SpeciesHomo sapiens (Human)
UniProt IDA8MS94
Gene Name
Protein NamePutative golgin subfamily A member 2-like protein 5
Region Expressed1-110
Expression Tag6xHis
Purity>90%
AA SequenceMPSILEDLKSREAMVAFLNSALVSAEEEQQAQLHGQLKEQRVCCQHLAHPVALAQKEPEA AAPTPRTGGDSACGETLQAVENLSYKLARVYSSHECCQIHLLIIGVYIFI
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review