Request QuoteCatalog Number: xP428496HUSize: 0.2-1mg

Request Quote

Recombinant Putative fatty acid-binding protein 5-like protein 3 (FABP5P3)

Recombinant Putative fatty acid-binding protein 5-like protein 3 (FABP5P3) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP428496HUYeast1mgQuote
EP428496HUE. coli1mgQuote
BP428496HUBaculovirus200ugQuote
MP428496HUMammalian Cell200ugQuote

Protein Information

SpeciesHomo sapiens (Human)
UniProt IDA8MUU1
Gene NameFABP5P3; aka: FABP5L3
Protein NamePutative fatty acid-binding protein 5-like protein 3
Region Expressed1-101
Expression Tag6xHis
Purity>90%
AA SequenceMGAMAKPDCIITCDSKNLTIKTESTLKTTQFSGTLGEKFEENTADGRRTQTVCNFTDGAL VQHQEWDGKESTITRKLKDGKLVVERVMNHVACTRIYEKAQ
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review