Request QuoteCatalog Number: xP427933HUSize: 0.2-1mg

Request Quote

Recombinant Putative BMS1-like protein ENSP00000383048

Recombinant Putative BMS1-like protein ENSP00000383048 can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP427933HUYeast1mgQuote
EP427933HUE. coli1mgQuote
BP427933HUBaculovirus200ugQuote
MP427933HUMammalian Cell200ugQuote

Protein Information

SpeciesHomo sapiens (Human)
UniProt IDA8MXU9
Gene Name
Protein NamePutative BMS1-like protein ENSP00000383048
Region Expressed1-101
Expression Tag6xHis
Purity>90%
AA SequenceMYVRVEIENVPCEFVQNIDPHYPIILGGLGNSEGNVGYVEMHLKKHRWYKKILKSRDPII FSVGWRRFQTIPLYYIEDHNGRQRLLKYTPQHMHCGAAFWA
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review