Request QuoteCatalog Number: xP520415DQQSize: 0.2-1mg

Request Quote

Recombinant Putative aminoacrylate peracid reductase RutC (rutC)

Recombinant Putative aminoacrylate peracid reductase RutC (rutC) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP520415DQQYeast1mgQuote
EP520415DQQE. coli1mgQuote
BP520415DQQBaculovirus200ugQuote
MP520415DQQMammalian Cell200ugQuote

Protein Information

SpeciesCaulobacter segnis (strain ATCC 21756 / DSM 7131 / JCM 7823 / NBRC 15250 / LMG 17158 / TK0059) (Mycoplana segnis)
UniProt IDD5VGV2
Gene NamerutC; Locus:Cseg_2079
Protein NamePutative aminoacrylate peracid reductase RutC
Region Expressed1-129
Expression Tag6xHis
Purity>90%
AA SequenceMPKTVITPPGTGTPIAPFSPGTLADGIVYVSGTLAFDKDNNVAFPGDAEAQTRQVLETIK SVIETAGGTMEDVVMNHIFLTDWVHYAPMNKVYAEYFPGDKPARYCIQCGLVKPGFVVEI ASVAHIGKP
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review