Request QuoteCatalog Number: xP351054RASize: 0.2-1mg

Request Quote

Recombinant Putative 60S ribosomal protein L37a (Rpl37a-ps1)

Recombinant Putative 60S ribosomal protein L37a (Rpl37a-ps1) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP351054RAYeast1mgQuote
EP351054RAE. coli1mgQuote
BP351054RABaculovirus200ugQuote
MP351054RAMammalian Cell200ugQuote

Protein Information

SpeciesRattus norvegicus (Rat)
UniProt IDP61515
Gene NameRpl37a-ps1
Protein NamePutative 60S ribosomal protein L37a
Region Expressed1-92
Expression Tag6xHis
Purity>90%
AA SequenceMAKRTKKVGIVGKYGTRYGASLRKMVKKIEISQHAKYTCSFCGKTKMKRRAVGIWHCGSC MKTVAGGAWTYNTTSAVTVKSAIRRLKELKDQ
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review