Request QuoteCatalog Number: xP026272HUSize: 0.2-1mg

Request Quote

Recombinant Protein yippee-like 3 (YPEL3)

Recombinant Protein yippee-like 3 (YPEL3) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP026272HUYeast1mgQuote
EP026272HUE. coli1mgEP026272HU
BP026272HUBaculovirus200ugQuote
MP026272HUMammalian Cell200ugQuote

Protein Information

SpeciesHomo sapiens (Human)
UniProt IDP61236
Gene NameYPEL3; ORFs:FKSG5
Protein NameProtein yippee-like 3
Region Expressed1-119
Expression Tag6xHis
Purity>90%
AA SequenceMVRISKPKTFQAYLDDCHRRYSCAHCRAHLANHDDLISKSFQGSQGRAYLFNSVVNVGCG PAEERVLLTGLHAVADIHCENCKTTLGWKYEQAFESSQKYKEGKYIIELNHMIKDNGWD
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review