Protein psbN (psbN) -->

Request QuoteCatalog Number: xP522746DZVSize: 0.2-1mg

Recombinant Protein psbN (psbN)

Recombinant Protein psbN (psbN) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog Number	Expression Host	Amount	In Stock
YP522746DZV	Yeast	1mg	Quote
EP522746DZV	E. coli	1mg	Quote
BP522746DZV	Baculovirus	200ug	Quote
MP522746DZV	Mammalian Cell	200ug	Quote

Protein Information

Species	Cyanidium caldarium
UniProt ID	O19926
Gene Name	psbN
Protein Name	Protein psbN
Region Expressed	1-43
Expression Tag	6xHis
Purity	>90%
AA Sequence	MEKALILSIFIFSLLLGITSYSIYISFGPLSKTLRDPFEEHEE
Storage Buffer	PBS pH 7.4, 50% glycerol
Storage	Store working aliquots at 4^oC for upto a week. Freeze at -20 to -80^oC for long term storage. Avoid repeated freeze/thaw.

Request Quote

ReviewsWrite Review

Products