Request QuoteCatalog Number: xP530344RASize: 0.2-1mg

Request Quote

Recombinant Prolactin-inducible protein homolog (Pip)

Recombinant Prolactin-inducible protein homolog (Pip) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP530344RAYeast1mgYP530344RA
EP530344RAE. coli1mgRPM035Ra02
BP530344RABaculovirus200ugQuote
MP530344RAMammalian Cell200ugQuote

Protein Information

SpeciesRattus norvegicus (Rat)
UniProt IDO70417
Gene NamePip
Protein NameProlactin-inducible protein homolog
Region Expressed27-146
Expression Tag6xHis
Purity>90%
AA SequenceQDNETIPQPLLFQLNVPSTPDENQEVDMSLTLQTQYKECLVVKAYLISNTPVDGGFNYIQ TRCICNDHPTTLYWTFVVTQTLTFRIMVDIVKDKGICPNNVAVVPISGNRYFTDRTVYVN
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review