Request QuoteCatalog Number: xP520433BTRSize: 0.2-1mg

Request Quote

Recombinant Probable salivary secreted peptide

Recombinant Probable salivary secreted peptide can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP520433BTRYeast1mgQuote
EP520433BTRE. coli1mgQuote
BP520433BTRBaculovirus200ugQuote
MP520433BTRMammalian Cell200ugQuote

Protein Information

SpeciesBombus ignitus (Bumblebee)
UniProt IDD8KY57
Gene Name
Protein NameProbable salivary secreted peptide
Region Expressed25-134
Expression Tag6xHis
Purity>90%
AA SequenceAPPVGHYAANNTNKSHNLVVGYRMPGDRLVLRQSVIKNSSWGRIVVEERTFNVSSWERIT MIQALDQKTNGNGAYASITNGGPGNQNVTIRLKSQRGHGINFVIEIYSRY
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review