Request QuoteCatalog Number: xP307176BOSize: 0.2-1mg

Request Quote

Recombinant Pregnancy-associated protein bPAP

Recombinant Pregnancy-associated protein bPAP can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP307176BOYeast1mgQuote
EP307176BOE. coli1mgQuote
BP307176BOBaculovirus200ugQuote
MP307176BOMammalian Cell200ugQuote

Protein Information

SpeciesBos taurus (Bovine)
UniProt IDP84291
Gene Name
Protein NamePregnancy-associated protein bPAP
Region Expressed1-100
Expression Tag6xHis
Purity>90%
AA SequenceDSELAGPRGARGPHGLSGPHGLSGLXGPXGYTGPIGMXGLTGLRREESEKVWLESKDGQE LELVSSGSAQEELELVSSGSAQVSFASYLGASQPLPSELW
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review