1- (5-phosphoribosyl) -->

Request QuoteCatalog Number: xP739862SKWSize: 0.2-1mg

Recombinant 1- (5-phosphoribosyl) -5-[ (5-phosphoribosylamino) methylideneamino] imidazole-4-carboxamide isomerase (hisA)

Recombinant 1- (5-phosphoribosyl) -5-[ (5-phosphoribosylamino) methylideneamino] imidazole-4-carboxamide isomerase (hisA) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog Number	Expression Host	Amount	In Stock
YP739862SKW	Yeast	1mg	Quote
EP739862SKW	E. coli	1mg	Quote
BP739862SKW	Baculovirus	200ug	Quote
MP739862SKW	Mammalian Cell	200ug	Quote

Protein Information

Species	Staphylococcus aureus (strain MSSA476)
UniProt ID	Q6G601
Gene Name	hisA; Locus:SAS2559
Protein Name	1- (5-phosphoribosyl) -5-[ (5-phosphoribosylamino) methylideneamino] imidazole-4-carboxamide isomerase
Region Expressed	1-234
Expression Tag	6xHis
Purity	>90%
AA Sequence	MIELWPAIDLIGSTSVRLTEGKYDSEEKMSRSAEESIAYYSQFECVNRIHIVDLIGAKAQ HAREFDYIKSLRRLTTKDIEVGGGIRTKSQIMDYFAAGINYCIVGTKGIQDTDWLKEMAH TFPGRIYLSVDAYGEDIKVNGWEEDTELNLFSFVRRLSDIPLGGIIYTDIAKDGKMSGPN FELTGQLVKATTIPVIASGGIRHQQDIQRLASLNVHAAIIGKAAHQASFWEGLK
Storage Buffer	PBS pH 7.4, 50% glycerol
Storage	Store working aliquots at 4^oC for upto a week. Freeze at -20 to -80^oC for long term storage. Avoid repeated freeze/thaw.

Request Quote

ReviewsWrite Review

Products