1- (5-phosphoribosyl) -->

Request QuoteCatalog Number: xP496525BYPSize: 0.2-1mg

Recombinant 1- (5-phosphoribosyl) -5-[ (5-phosphoribosylamino) methylideneamino] imidazole-4-carboxamide isomerase

Recombinant 1- (5-phosphoribosyl) -5-[ (5-phosphoribosylamino) methylideneamino] imidazole-4-carboxamide isomerase can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog Number	Expression Host	Amount	In Stock
YP496525BYP	Yeast	1mg	Quote
EP496525BYP	E. coli	1mg	Quote
BP496525BYP	Baculovirus	200ug	Quote
MP496525BYP	Mammalian Cell	200ug	Quote

Protein Information

Species	Anaerocellum thermophilum (strain DSM 6725 / Z-1320)
UniProt ID	B9MJR4
Gene Name	hisA; Locus:Athe_1474
Protein Name	1- (5-phosphoribosyl) -5-[ (5-phosphoribosylamino) methylideneamino] imidazole-4-carboxamide isomerase
Region Expressed	1-237
Expression Tag	6xHis
Purity	>90%
AA Sequence	MIVIPAIDLIDGKCVRLTQGDYSQVQLFNSDPIEQAKLFEKSGAKYVHVVDLDGAKVGRP VNFEVIRNIKRVTSLTVECGGGIRDKATVELYISSGVNYIILGSVIFKNPDFVNEVMKVF GKERFIASLDFKDGFVKLSGWQEATTITIEEGIMKIKTLGFERLIYTDITTDGMLKGHNF EAAKYIRELFDGFLTASGGISTKEDIMRLKSIGVDAAVVGKALYTGQLKLEEVINLL
Storage Buffer	PBS pH 7.4, 50% glycerol
Storage	Store working aliquots at 4^oC for upto a week. Freeze at -20 to -80^oC for long term storage. Avoid repeated freeze/thaw.

Request Quote

ReviewsWrite Review

Products