Request QuoteCatalog Number: xP517279MUASize: 0.2-1mg

Request Quote

Recombinant Phospholipase A2 homolog Tx-beta

Recombinant Phospholipase A2 homolog Tx-beta can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP517279MUAYeast1mgQuote
EP517279MUAE. coli1mgQuote
BP517279MUABaculovirus200ugQuote
MP517279MUAMammalian Cell200ugQuote

Protein Information

SpeciesMicrurus tener tener (Texas coral snake)
UniProt IDG9I930
Gene Name
Protein NamePhospholipase A2 homolog Tx-beta
Region Expressed31-149
Expression Tag6xHis
Purity>90%
AA SequenceNLNQFRLMIKCTNDRVWADFVDYGCYCVARDSNTPVDDLDRCCQAQKQCYDEAVKVHGCK PLVMFYSFECRYLASDLDCSGNNTKCRNFVCNCDRTATLCILTATYNRNNHKIDPSRCQ
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review